{"product_id":"proteintech-83439-1-rr","title":"Proteintech, 83439-1-RR, POLR2H Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe POLR2H (83439-1-RR) by Proteintech is a Recombinant antibody targeting POLR2H in WB, ELISA applications with reactivity to Human, mouse samples\n83439-1-RR targets POLR2H in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HL-60 cells,  HepG2 cells,  NIH\/3T3 cells,  Jurkat cells,  SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOLR2H, also known as hRPB8, is a 150 amino acid protein, which localizes in nucleolus and is expressed in 228 organ(s), highest expression level in mucosa of transverse colon. POLR2H. POLR2H is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR2H is a common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7166 Product name: Recombinant human POLR2H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC000739 Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF Predict reactive species\nFull Name: polymerase (RNA) II (DNA directed) polypeptide H\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 15-17 kDa\nGenBank Accession Number: BC000739\nGene Symbol: POLR2H\nGene ID (NCBI): 5437\nRRID: AB_3671080\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P52434\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888658665641,"sku":"83439-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83439-1-rr","provider":"Iright","version":"1.0","type":"link"}