{"product_id":"proteintech-83440-2-rr","title":"Proteintech, 83440-2-RR, TMEM126A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMEM126A (83440-2-RR) by Proteintech is a Recombinant antibody targeting TMEM126A in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83440-2-RR targets TMEM126A in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells, HeLa cells,  MCF-7 cells,  U-251 cells,  U2OS cells,  human placenta tissue\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM126A is a mitochondrial inner membrane protein that is enriched in the cristae. TMEM126A is necessary for Complex I assembly or stability.Complex I (CI) is the largest enzyme of the mitochondrial respiratory chain, and its defects are the main cause of mitochondrial disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14705 Product name: Recombinant human TMEM126A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-195 aa of BC007875 Sequence: AGLPMAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH Predict reactive species\nFull Name: transmembrane protein 126A\nCalculated Molecular Weight: 195 aa, 22 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC007875\nGene Symbol: TMEM126A\nGene ID (NCBI): 84233\nRRID: AB_3671081\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H061\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888520351913,"sku":"83440-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83440-2-rr","provider":"Iright","version":"1.0","type":"link"}