{"product_id":"proteintech-83452-4-rr","title":"Proteintech, 83452-4-RR, GNB3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GNB3 (83452-4-RR) by Proteintech is a Recombinant antibody targeting GNB3 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83452-4-RR targets GNB3 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, L02 cells,  HepG2 cells,  C6 cells,  mouse brain tissue,  mouse cerebellum tissue,  rat brain tissue\nPositive FC (Intra) detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0127 Product name: Recombinant human GNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of BC000115 Sequence: MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESII Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), beta polypeptide 3\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 35-37 kDa\nGenBank Accession Number: BC000115\nGene Symbol: GNB3\nGene ID (NCBI): 2784\nRRID: AB_3671089\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P16520\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888428109993,"sku":"83452-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83452-4-rr","provider":"Iright","version":"1.0","type":"link"}