{"product_id":"proteintech-83473-3-rr","title":"Proteintech, 83473-3-RR, DENND6A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DENND6A (83473-3-RR) by Proteintech is a Recombinant antibody targeting DENND6A in WB, FC (Intra), ELISA applications with reactivity to human samples\n83473-3-RR targets DENND6A in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, HEK-293 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM116A has DENN-related domains, which are required for cell migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22052 Product name: Recombinant human FAM116A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC040291 Sequence: MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSA Predict reactive species\nFull Name: family with sequence similarity 116, member A\nCalculated Molecular Weight: 608 aa, 70 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC040291\nGene Symbol: FAM116A\nGene ID (NCBI): 201627\nRRID: AB_3671102\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8IWF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888419459241,"sku":"83473-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83473-3-rr","provider":"Iright","version":"1.0","type":"link"}