{"product_id":"proteintech-83476-6-rr","title":"Proteintech, 83476-6-RR, FOXC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FOXC2 (83476-6-RR) by Proteintech is a Recombinant antibody targeting FOXC2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83476-6-RR targets FOXC2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, A 375 cells,  HCT 116 cells,  MCF-7 cells,  HepG2 cells,  MDA-MB-453 cells,  SW480 cells\nPositive FC (Intra) detected in: A549 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nForkhead box protein C2 (FOXC2) also known as forkhead-related protein FKHL14 (FKHL14), transcription factor FKH-14, or mesenchyme fork head protein 1 (MFH1) is a protein that in humans is encoded by the FOXC2 gene. FOXC2 is a member of the fork head box (FOX) family of transcription factors. FOX transcription factors are expressed during development and are associated with a number of cellular and developmental differentiation processes. FOXC2 is required during early development of the kidneys, including differentiation of podocytes and maturation of the glomerular basement membrane. It is also involved in the early development of the heart. FOXC2 is also involved in cancer metastases. In particular, expression of FOXC2 is induced when epithelial cells undergo an epithelial-mesenchymal transition (EMT) and become mesenchymal looking cells. (PMID: 8674414 9169153 19935708) This antibody recognizes the 56 kDa FOXC2 protein, but the phosphorylated FOXC2 may be a 56-65 kDa protein. The 62kDa band was also detected in the study(PMID: 19540201).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33121 Product name: Recombinant human FOXC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 205-501 aa of NM_005251 Sequence: KEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY* Predict reactive species\nFull Name: forkhead box C2 (MFH-1, mesenchyme forkhead 1)\nCalculated Molecular Weight: 54kd\nObserved Molecular Weight: 54-68 kDa\nGenBank Accession Number: NM_005251\nGene Symbol: FOXC2\nGene ID (NCBI): 2303\nRRID: AB_3671105\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q99958\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888753037481,"sku":"83476-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83476-6-rr","provider":"Iright","version":"1.0","type":"link"}