{"product_id":"proteintech-83500-4-rr","title":"Proteintech, 83500-4-RR, C6orf130 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe C6orf130 (83500-4-RR) by Proteintech is a Recombinant antibody targeting C6orf130 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83500-4-RR targets C6orf130 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HCT 116 cells\nPositive FC (Intra) detected in: A431 cells, PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOARD1 (O-acetyl-ADP-ribose deacetylase 1), also known as TARG1 (Terminal ADP-ribose protein glycohydrolase 1) and C6orf130, is a ADP-ribose glycohydrolase that hydrolyzes ADP-ribose and acts on different substrates, such as proteins ADP-ribosylated on glutamate and O-acetyl-ADP-D-ribose (PMID: 21849506; 23474714; 23481255). The MW of this protein is 17 kDa, and this antibody specially recognises the 17 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19341 Product name: Recombinant human C6orf130 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC011709 Sequence: MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL Predict reactive species\nFull Name: chromosome 6 open reading frame 130\nCalculated Molecular Weight: 152 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC011709\nGene Symbol: C6orf130\nGene ID (NCBI): 221443\nRRID: AB_3671126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9Y530\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888397635753,"sku":"83500-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83500-4-rr","provider":"Iright","version":"1.0","type":"link"}