{"product_id":"proteintech-83504-1-rr","title":"Proteintech, 83504-1-RR, Apolipoprotein AI Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Apolipoprotein AI (83504-1-RR) by Proteintech is a Recombinant antibody targeting Apolipoprotein AI in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83504-1-RR targets Apolipoprotein AI in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid\/cholesterol binding, lecithin\/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0757 Product name: Recombinant Human APOA1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-267 aa of BC005380 Sequence: DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ Predict reactive species\nFull Name: apolipoprotein A-I\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC005380\nGene Symbol: APOA1\nGene ID (NCBI): 335\nRRID: AB_3671129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P02647\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888388329641,"sku":"83504-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83504-1-rr","provider":"Iright","version":"1.0","type":"link"}