{"product_id":"proteintech-83505-1-rr","title":"Proteintech, 83505-1-RR, SLC17A9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC17A9 (83505-1-RR) by Proteintech is a Recombinant antibody targeting SLC17A9 in WB, IHC, FC (Intra), ELISA applications with reactivity to mouse, rat samples\n83505-1-RR targets SLC17A9 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse pancreas tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species\nFull Name: solute carrier family 17, member 9\nCalculated Molecular Weight: 436 aa, 47 kDa\nObserved Molecular Weight: 50 kD\nGenBank Accession Number: BC025312\nGene Symbol: SLC17A9\nGene ID (NCBI): 63910\nRRID: AB_3671130\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9BYT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888350318761,"sku":"83505-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83505-1-rr","provider":"Iright","version":"1.0","type":"link"}