{"product_id":"proteintech-83509-6-rr","title":"Proteintech, 83509-6-RR, FBXO38 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FBXO38 (83509-6-RR) by Proteintech is a Recombinant antibody targeting FBXO38 in WB, ELISA applications with reactivity to human samples\n83509-6-RR targets FBXO38 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  K-562 cells,  Jurkat cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO38, also known as HMN2D, MOKA, and SP329, is a protein that plays a significant role in the regulation of immune responses, particularly in the context of cancer and autoimmune diseases. FBXO38 has been identified as an E3 ubiquitin ligase that mediates the degradation of PD-1 (Programmed cell death protein 1), a key immune checkpoint protein expressed on the surface of T cells. The internalization, ubiquitination, and proteasome degradation of PD-1 are facilitated by FBXO38, which links PD-1 to Lys48, leading to its poly-ubiquitination and subsequent degradation (PMID: 30487606).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35444 Product name: Recombinant human FBXO38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-700 aa of XM_005268513.1 Sequence: SNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDV Predict reactive species\nFull Name: F-box protein 38\nCalculated Molecular Weight: 134kDa，1188aa\nObserved Molecular Weight: 133 kDa\nGenBank Accession Number: XM_005268513.1\nGene Symbol: FBXO38\nGene ID (NCBI): 81545\nRRID: AB_3671134\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q6PIJ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888369848489,"sku":"83509-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83509-6-rr","provider":"Iright","version":"1.0","type":"link"}