{"product_id":"proteintech-83550-4-rr","title":"Proteintech, 83550-4-RR, Chemerin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Chemerin (83550-4-RR) by Proteintech is a Recombinant antibody targeting Chemerin in WB, FC (Intra), ELISA applications with reactivity to mouse samples\n83550-4-RR targets Chemerin in WB, FC (Intra), ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse adipose tissue, mouse brown adipose tissue\nPositive FC (Intra) detected in: C57BL\/6 mouse liver cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0875 Product name: Recombinant mouse Chemerin protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-156 aa of NM_001347168.1 Sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS Predict reactive species\nFull Name: retinoic acid receptor responder (tazarotene induced) 2\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 14-19 kDa\nGenBank Accession Number: NM_001347168.1\nGene Symbol: Chemerin\nGene ID (NCBI): 71660\nRRID: AB_3671168\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9DD06\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888404254889,"sku":"83550-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83550-4-rr","provider":"Iright","version":"1.0","type":"link"}