{"product_id":"proteintech-83578-2-rr","title":"Proteintech, 83578-2-RR, S100A9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe S100A9 (83578-2-RR) by Proteintech is a Recombinant antibody targeting S100A9 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83578-2-RR targets S100A9 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, THP-1 cells,  HL-60 cells\nPositive IF\/ICC detected in: A549 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8\/A9), or as a heterotetramer with an S100A8 partner(S100A8\/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25764 Product name: Recombinant human S100A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC047681 Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species\nFull Name: S100 calcium binding protein A9\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC047681\nGene Symbol: S100A9\nGene ID (NCBI): 6280\nRRID: AB_3671190\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P06702\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888535326889,"sku":"83578-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83578-2-rr","provider":"Iright","version":"1.0","type":"link"}