{"product_id":"proteintech-83607-6-rr","title":"Proteintech, 83607-6-RR, POMP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe POMP (83607-6-RR) by Proteintech is a Recombinant antibody targeting POMP in WB, ELISA applications with reactivity to human, rat samples\n83607-6-RR targets POMP in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  rat skin tissue,  Jurkat cells,  SW480 cells,  HL-60 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProteasome maturation protein(POMP), is an essential factor of mammalian proteasome biogenesis. It facilitates the main steps in 20S core complex formation at the ER to coordinate the assembly process and to provide cells with freshly formed proteasomes at their site of function. A single nucleotide deletion in this gene causes an autosomal recessive skin disorder, keratosis linearis with ichthyosis congenita and sclerosing keratoderma (KLICK) syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6987 Product name: Recombinant human POMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC003390 Sequence: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL Predict reactive species\nFull Name: proteasome maturation protein\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC003390\nGene Symbol: POMP\nGene ID (NCBI): 51371\nRRID: AB_3671220\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9Y244\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888658796713,"sku":"83607-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83607-6-rr","provider":"Iright","version":"1.0","type":"link"}