{"product_id":"proteintech-83613-6-rr","title":"Proteintech, 83613-6-RR, AP1M1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AP1M1 (83613-6-RR) by Proteintech is a Recombinant antibody targeting AP1M1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83613-6-RR targets AP1M1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  mouse testis tissue,  PC-3 cells,  K-562 cells,  Jurkat cells,  rat testis tissue\nPositive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells, U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2757 Product name: Recombinant human AP1M1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-423 aa of BC017469 Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ Predict reactive species\nFull Name: adaptor-related protein complex 1, mu 1 subunit\nCalculated Molecular Weight: 423 aa, 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC017469\nGene Symbol: AP1M1\nGene ID (NCBI): 8907\nRRID: AB_3671226\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9BXS5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888388165801,"sku":"83613-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83613-6-rr","provider":"Iright","version":"1.0","type":"link"}