{"product_id":"proteintech-83620-5-rr","title":"Proteintech, 83620-5-RR, Neurofibromin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Neurofibromin (83620-5-RR) by Proteintech is a Recombinant antibody targeting Neurofibromin in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83620-5-RR targets Neurofibromin in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, PC-12 cell,  NIH\/3T3 cells,  HEK-293T cells,  HeLa cells\nPositive FC (Intra) detected in: HeLa cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNF1 codes for neurofibromin,  a GTPase-activating protein that negatively regulates RAS\/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25799 Product name: Recombinant human Neurofibromin protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of M60915 Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD Predict reactive species\nFull Name: neurofibromin 1\nCalculated Molecular Weight: 319 kDa\nObserved Molecular Weight: 250-280 kDa\nGenBank Accession Number: M60915\nGene Symbol: Neurofibromin 1\nGene ID (NCBI): 4763\nRRID: AB_3671233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P21359\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888437055657,"sku":"83620-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83620-5-rr","provider":"Iright","version":"1.0","type":"link"}