{"product_id":"proteintech-83627-1-rr","title":"Proteintech, 83627-1-RR, Timp-3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Timp-3 (83627-1-RR) by Proteintech is a Recombinant antibody targeting Timp-3 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n83627-1-RR targets Timp-3 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human tonsillitis tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells, MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTimp-3 (TIMP metallopeptidase inhibitor 3), also known as SFD. It is expected to be located in extracellular space, and the protein is enriched in the placenta tissue and fat tissue. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation, and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. TIMP-3 is expressed as an unglycosylated 24 kDa and glycosylated 29 kDa protein with inhibitory activity against interstitial collagenase, stromelysin-1, and gelatinases A and B (PMID:11827795).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34657 Product name: Recombinant human Timp-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-211 aa of BC014277 Sequence: MLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP Predict reactive species\nFull Name: TIMP metallopeptidase inhibitor 3\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24-33 kDa\nGenBank Accession Number: BC014277\nGene Symbol: TIMP3\nGene ID (NCBI): 7078\nRRID: AB_3671240\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P35625\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888520122537,"sku":"83627-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83627-1-rr","provider":"Iright","version":"1.0","type":"link"}