{"product_id":"proteintech-83638-3-rr","title":"Proteintech, 83638-3-RR, RCN1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RCN1 (83638-3-RR) by Proteintech is a Recombinant antibody targeting RCN1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83638-3-RR targets RCN1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A375 cells,  SH-SY5Y cells,  HuH-7 cells\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nReticulocalbin-1 (RCN1) belongs to the CREC family. Reticulocalbin‐1, an endoplasmic reticulum protein, plays a crucial role in calcium homeostasis and inhibits ER stress‐induced apoptosis (PMID: 28319095). Its main functions include maintaining intracellular homeostasis and regulating cell proliferation and apoptosis, and it plays an important role in the development of various tumours (PMID: 38057406). RCN1 is expressed aberrantly and at a high level in various tumors, including acute myeloid leukemia (AML) (PMID: 37746742). In multiple cancers, such as glioblastoma, non‐small cell lung cancer, renal cell carcinoma, hepatocellular carcinoma, and oral squamous cell carcinoma, the overexpression of RCN1 has been observed indicating its involvement in tumorigenesis and invasion (PMID: 30172915, PMID: 34722631).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13256 Product name: Recombinant human RCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC010120 Sequence: MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHW Predict reactive species\nFull Name: reticulocalbin 1, EF-hand calcium binding domain\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 44-46 kDa\nGenBank Accession Number: BC010120\nGene Symbol: RCN1\nGene ID (NCBI): 5954\nRRID: AB_3671250\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15293\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888441381033,"sku":"83638-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83638-3-rr","provider":"Iright","version":"1.0","type":"link"}