{"product_id":"proteintech-83649-5-rr","title":"Proteintech, 83649-5-RR, Involucrin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Involucrin (83649-5-RR) by Proteintech is a Recombinant antibody targeting Involucrin in WB, IHC, ELISA applications with reactivity to human samples\n83649-5-RR targets Involucrin in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HaCaT cells,  HT-29 cells,  HT-1080 cells\nPositive IHC detected in: human skin tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInvolucrin is a protein precursor of the epidermal cornified envelope that is assembled in the outermost layers of the epidermis. Involucrin expression is restricted to the suprabasal epidermal layers (spinous and granular layers) during normal keratinocyte differentiation and is a useful marker of terminal differentiation. The predicted MW of involucrin is 68 kDa, but it also forms 120 kDa dimers, while different reports provided variable results ranging from 90-140 kDa. (PMID: 11099111, 1503502, 12150517)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29585 Product name: Recombinant human Involucrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-361 aa of NM_005547 Sequence: EVPSKQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEG Predict reactive species\nFull Name: involucrin\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_005547\nGene Symbol: Involucrin\nGene ID (NCBI): 3713\nRRID: AB_3671258\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P07476\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888644968617,"sku":"83649-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83649-5-rr","provider":"Iright","version":"1.0","type":"link"}