{"product_id":"proteintech-83650-1-rr","title":"Proteintech, 83650-1-RR, RNASET2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RNASET2 (83650-1-RR) by Proteintech is a Recombinant antibody targeting RNASET2 in WB, ELISA applications with reactivity to human samples\n83650-1-RR targets RNASET2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HL-60 cells,  THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNASET2(Ribonuclease T2) is also named as RNASE6PL(Ribonuclease 6) and belongs to the RNase T2 family. It is a unique member of the growing family of tumor-antagonizing genes and behaves as a class II tumor suppressor and abolish the tumorigenic potential of an ovarian cancer-derived cell line. This protein has 2 isoforms produced by alternative splicing. Both mildly glycosylated (ranging from38 to 45 kDa) and highly glycosylated forms (ranging from 50 to 80 kDa) of human tumor suppressor protein RNASET2 can be detected in immunoblotting in P. Pastoris(PMID: 21446958).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28353 Product name: Recombinant human RNASET2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-256 aa of BC039713 Sequence: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH Predict reactive species\nFull Name: ribonuclease T2\nCalculated Molecular Weight: 256 aa, 29 kDa\nObserved Molecular Weight: 25-45 kDa\nGenBank Accession Number: BC039713\nGene Symbol: RNase T2\nGene ID (NCBI): 8635\nRRID: AB_3671259\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O00584\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888660992169,"sku":"83650-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83650-1-rr","provider":"Iright","version":"1.0","type":"link"}