{"product_id":"proteintech-83675-6-rr","title":"Proteintech, 83675-6-RR, SCTR Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SCTR (83675-6-RR) by Proteintech is a Recombinant antibody targeting SCTR in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83675-6-RR targets SCTR in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, mouse pancreas tissue\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCTR is a member of the family B G protein-coupled receptors. SCTR is a receptor for SCT, a gastrointestinal peptide hormone secreted by the S cells of the duodenum. SCT regulates water homeostasis throughout the body and influences the environment of the duodenum by regulating SCT in the stomach and pancreas. Studies suggest that SCT can act as a neuropeptide within the central nervous system (CNS), thus SCTR may regulate the function of the CNS.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5371 Product name: Recombinant human SCTR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-142 aa of BC035757 Sequence: QVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL Predict reactive species\nFull Name: SCTR\nCalculated Molecular Weight: 440 aa, 50 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC035757\nGene Symbol: SCTR\nGene ID (NCBI): 6344\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P47872\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888819687593,"sku":"83675-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83675-6-rr","provider":"Iright","version":"1.0","type":"link"}