{"product_id":"proteintech-83731-2-rr","title":"Proteintech, 83731-2-RR, ACOX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ACOX1 (83731-2-RR) by Proteintech is a Recombinant antibody targeting ACOX1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83731-2-RR targets ACOX1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human ovarian  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1405 Product name: Recombinant human AOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 275-660 aa of BC010425 Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL Predict reactive species\nFull Name: acyl-Coenzyme A oxidase 1, palmitoyl\nCalculated Molecular Weight: 74 kDa\nObserved Molecular Weight: 70-74 kDa, 22 kDa\nGenBank Accession Number: BC010425\nGene Symbol: ACOX1\nGene ID (NCBI): 51\nRRID: AB_3671331\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15067\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888340816041,"sku":"83731-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83731-2-rr","provider":"Iright","version":"1.0","type":"link"}