{"product_id":"proteintech-83732-2-rr","title":"Proteintech, 83732-2-RR, POT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe POT1 (83732-2-RR) by Proteintech is a Recombinant antibody targeting POT1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83732-2-RR targets POT1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: U2OS cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtection of telomeres 1(POT1) is a conserved protein that binds the G-rich stand of its own telomeric repeat sequence, with a role in protecting chromosome ends. It's housekeeping gene that is required to ensure the integrity of chromosome ends in all cells. It's a component of the telomerase ribonucleoprotein(RNP) complex that is esential for the replication of chromosome termini. It consists the TRF1 compex that is involved in the regulation of telomere length by cis-inhibition of telomerase. We have discovered that POT1 exists in at least three consistently occurring forms; 90, 70 and 45kDa. The unexpected molecular weights of POT1 seem to be associated with SUMO1 and ubiquitin conjugation; the latter occurring at a double lysine residue at 289-KK-290 (.PMID: 24054699)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0875 Product name: Recombinant human POT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-634 aa of BC002923 Sequence: ILTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI Predict reactive species\nFull Name: POT1 protection of telomeres 1 homolog (S. pombe)\nCalculated Molecular Weight: 71 kDa\nGenBank Accession Number: BC002923\nGene Symbol: POT1\nGene ID (NCBI): 25913\nRRID: AB_3671332\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NUX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888864350377,"sku":"83732-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83732-2-rr","provider":"Iright","version":"1.0","type":"link"}