{"product_id":"proteintech-83739-3-rr","title":"Proteintech, 83739-3-RR, Dectin-1\/CLEC7A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Dectin-1\/CLEC7A (83739-3-RR) by Proteintech is a Recombinant antibody targeting Dectin-1\/CLEC7A in WB, ELISA applications with reactivity to human, mouse samples\n83739-3-RR targets Dectin-1\/CLEC7A in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HL-60 cells,  mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1344 Product name: Recombinant Human Dectin-1 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 66-247 aa of NM_197947.3 Sequence: TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM Predict reactive species\nFull Name: C-type lectin domain family 7, member A\nCalculated Molecular Weight: 28kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_197947.3\nGene Symbol: Dectin-1\nGene ID (NCBI): 64581\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BXN2-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888735309993,"sku":"83739-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83739-3-rr","provider":"Iright","version":"1.0","type":"link"}