{"product_id":"proteintech-83770-5-rr","title":"Proteintech, 83770-5-RR, APOL1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe APOL1 (83770-5-RR) by Proteintech is a Recombinant antibody targeting APOL1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83770-5-RR targets APOL1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A375 cells,  HepG2 cells,  MCF-7 cells,  human plasma\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman apolipo-protein L1 (APOL1) is a minor component of plasma high density lipoprotein (HDL) particles, acting as an interacting protein of apolipoprotein A1 (ApoA1). The human ApoL protein family was thought to be predominantly involved in lipid transport and metabolism. APOL1 is also involved in host innate immunity against Trypanosoma parasites. Once activated, APOL1 can lyse the parasite and protect human from infection. Genetic variants in APOL1 gene, which are found in African ancestry with high frequency, associate with chronic kidney disease, like focal segmental glomerulosclerosis (FSGS), HIV-associated nephropathy (HIVAN), and hypertensive nephropathy. APOL1 share structural and functional similarities with proteins of the Bcl-2 family and may has roles in apoptosis and autophagy. It is notable that APOL1 exists only in human and a few other primate species, and mouse does not express an APOL1 orthologue.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2016 Product name: Recombinant human APOL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC017331 Sequence: MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA Predict reactive species\nFull Name: apolipoprotein L, 1\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC017331\nGene Symbol: APOL1\nGene ID (NCBI): 8542\nRRID: AB_3671364\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O14791\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888388264105,"sku":"83770-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83770-5-rr","provider":"Iright","version":"1.0","type":"link"}