{"product_id":"proteintech-83791-6-rr","title":"Proteintech, 83791-6-RR, CEBPB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CEBPB (83791-6-RR) by Proteintech is a Recombinant antibody targeting CEBPB in WB, IHC, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, mouse samples\n83791-6-RR targets CEBPB in WB, IHC, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  U-87 MG cells,  MKN-45 cells,  MDA-MB-231 cells\nPositive IHC detected in: human ovarian  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\nPositive ChIP-qPCR detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCAAT\/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein.Three variants of CEBPBs have been detected: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20 kDa liver-enriched transcription-inhibitory protein (LIP). (PMID:18820298).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag20073 Product name: Recombinant human CEBPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC007538 Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT Predict reactive species\nFull Name: CCAAT\/enhancer binding protein (C\/EBP), beta\nCalculated Molecular Weight: 345 aa, 36 kDa\nObserved Molecular Weight: 42 kDa, 46 kDa\nGenBank Accession Number: BC007538\nGene Symbol: CEBPB\nGene ID (NCBI): 1051\nRRID: AB_3671382\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P17676\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888404058281,"sku":"83791-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83791-6-rr","provider":"Iright","version":"1.0","type":"link"}