{"product_id":"proteintech-83803-2-rr","title":"Proteintech, 83803-2-RR, MITF Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MITF (83803-2-RR) by Proteintech is a Recombinant antibody targeting MITF in IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human samples\n83803-2-RR targets MITF in IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells,  A431 cells\nPositive FC (Intra) detected in: HeLa cells\nPositive ChIP-qPCR detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases (PMID:22523078). Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells (PMID: 10578055).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3679 Product name: Recombinant human MITF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species\nFull Name: microphthalmia-associated transcription factor\nCalculated Molecular Weight: 91 aa, 10 kDa, 59 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC012503\nGene Symbol: MITF\nGene ID (NCBI): 4286\nRRID: AB_3671391\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75030\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888861728937,"sku":"83803-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83803-2-rr","provider":"Iright","version":"1.0","type":"link"}