{"product_id":"proteintech-83814-1-rr","title":"Proteintech, 83814-1-RR, PRM2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PRM2 (83814-1-RR) by Proteintech is a Recombinant antibody targeting PRM2 in WB, ELISA applications with reactivity to Human samples\n83814-1-RR targets PRM2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRM2 (Protamine-2) is the main DNA-binding protein in the sperm nucleus, consisting of a C-terminal mature PRM2 (mPRM2) domain and an N-terminal lytic PRM2 (cPRM2) domain, which is lyzed sequentially after binding to DNA. PRM2 plays an important role in spermatogenesis and development. PRM2 is specifically expressed in sperm and localized in the sperm nucleus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5952 Product name: Recombinant human PRM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC066338 Sequence: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH Predict reactive species\nFull Name: protamine 2\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 10-20 kDa\nGenBank Accession Number: BC066338\nGene Symbol: PRM2\nGene ID (NCBI): 5620\nRRID: AB_3671401\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P04554\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888659026089,"sku":"83814-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83814-1-rr","provider":"Iright","version":"1.0","type":"link"}