{"product_id":"proteintech-83820-5-rr","title":"Proteintech, 83820-5-RR, CPNE3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CPNE3 (83820-5-RR) by Proteintech is a Recombinant antibody targeting CPNE3 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n83820-5-RR targets CPNE3 in WB, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells, A431 cells,  HepG2 cells,  A549 cells,  HeLa cells,  HuH-7 cells\nPositive IP detected in: HepG2 cells\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCopines are a family of evolutionarily conserved calcium-dependent phospholipid-binding proteins (PMID: 9430674). They contain two Ca(2+)- and phospholipid-binding domains known as C2 domains. Copines are potentially involved in regulating membrane trafficking and in protein-protein interactions. Copine III (CPNE3) has also been identified as a ligand of ERBB2 and plays an important role in various carcinogenesis. The high expression of CPNE3 is an adverse prognostic biomarker for acute myeloid leukemia (PMID: 28670859).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1634 Product name: Recombinant human CPNE3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-537 aa of BC036242 Sequence: EASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTFLDYIMGGCQLNFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQIPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRSCLPQIKLYGQTNFSPIINHVARFAAAATQQQTASRYFVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLHSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ Predict reactive species\nFull Name: copine III\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC036242\nGene Symbol: CPNE3\nGene ID (NCBI): 8895\nRRID: AB_3671405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O75131\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888353333417,"sku":"83820-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83820-5-rr","provider":"Iright","version":"1.0","type":"link"}