{"product_id":"proteintech-83822-2-rr","title":"Proteintech, 83822-2-RR, COPS3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe COPS3 (83822-2-RR) by Proteintech is a Recombinant antibody targeting COPS3 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n83822-2-RR targets COPS3 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  HT-29 cells,  HEK-293T cells,  mouse ovary tissue,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\nPositive IF\/ICC detected in: A431 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOPS3 possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32825 Product name: Recombinant human COPS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-423 aa of BC001891 Sequence: NNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS Predict reactive species\nFull Name: COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC001891\nGene Symbol: COPS3\nGene ID (NCBI): 8533\nRRID: AB_3671406\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UNS2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888412872873,"sku":"83822-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83822-2-rr","provider":"Iright","version":"1.0","type":"link"}