{"product_id":"proteintech-83886-5-rr","title":"Proteintech, 83886-5-RR, CSDC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CSDC2 (83886-5-RR) by Proteintech is a Recombinant antibody targeting CSDC2 in WB, ELISA applications with reactivity to human samples\n83886-5-RR targets CSDC2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIPPIN, also known as CSDC2 (Cold shock domain-containing protein C2) is an RNA‐binding protein (RBP), highly enriched in the rat brain, specifically enriched in some pyramidal neurons of the cerebral cortex and in the Purkinje cells of the cerebellum (PMID: 10446180). PIPPIN has the potential to undergo different posttranslational modifications and might be a good candidate to regulate the synthesis of specific proteins in response to extracellular stimuli. Nuclear CSDC2 is connected to proliferation and cytoplasmic CSDC2 to terminal differentiation in the decidua and that CSDC2 could regulate differentiation during decidua development (PMID: 30078185, PMID: 17053029).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16216 Product name: Recombinant human CSDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC067113 Sequence: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEG Predict reactive species\nFull Name: cold shock domain containing C2, RNA binding\nCalculated Molecular Weight: 153 aa, 17 kDa\nObserved Molecular Weight: 20 kDa, 30 kDa\nGenBank Accession Number: BC067113\nGene Symbol: CSDC2\nGene ID (NCBI): 27254\nRRID: AB_3671468\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9Y534\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888608170153,"sku":"83886-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83886-5-rr","provider":"Iright","version":"1.0","type":"link"}