{"product_id":"proteintech-83887-4-rr","title":"Proteintech, 83887-4-RR, Tissue Factor\/CD142 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Tissue Factor\/CD142 (83887-4-RR) by Proteintech is a Recombinant antibody targeting Tissue Factor\/CD142 in WB, ELISA applications with reactivity to human, mouse, rat samples\n83887-4-RR targets Tissue Factor\/CD142 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse brain tissue,  SH-SY5Y cells,  NIH\/3T3 cells,  rat skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNormal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). This antibody is specific for mouse Tissue Factor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1102 Product name: Recombinant Mouse Tissue Factor protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-251 aa of Sequence: AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE Predict reactive species\nFull Name: coagulation factor III\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 48-53 kDa\nGene Symbol: Tissue Factor\nGene ID (NCBI): 14066\nRRID: AB_3671470\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P20352\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888669741225,"sku":"83887-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83887-4-rr","provider":"Iright","version":"1.0","type":"link"}