{"product_id":"proteintech-83927-1-rr","title":"Proteintech, 83927-1-RR, CXCR7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CXCR7 (83927-1-RR) by Proteintech is a Recombinant antibody targeting CXCR7 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83927-1-RR targets CXCR7 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  Raji cells,  U-87 MG cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a G-protein coupled receptor family member. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as a coreceptor with CXCR4 for a restricted number of HIV isolates. The expression of CXCR7 has been associated with cardiac development, tumor growth, and progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14247 Product name: Recombinant human CXCR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-362 aa of BC036661 Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Predict reactive species\nFull Name: chemokine (C-X-C motif) receptor 7\nCalculated Molecular Weight: 362 aa, 41 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC036661\nGene Symbol: CXCR7\nGene ID (NCBI): 57007\nRRID: AB_3671507\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P25106\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888418181289,"sku":"83927-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83927-1-rr","provider":"Iright","version":"1.0","type":"link"}