{"product_id":"proteintech-83944-1-rr","title":"Proteintech, 83944-1-RR, TOB1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TOB1 (83944-1-RR) by Proteintech is a Recombinant antibody targeting TOB1 in WB, ELISA applications with reactivity to human samples\n83944-1-RR targets TOB1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  HEK-293T cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2\/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization.The predicted MW of this protein is 38 kDa. Catalog#83944-1-RR recognises 38 and 45 kDa band, and the additional 45 kDa band may be due to phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6714 Product name: Recombinant human TOB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC031406 Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN Predict reactive species\nFull Name: transducer of ERBB2, 1\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 38-45 kDa\nGenBank Accession Number: BC031406\nGene Symbol: TOB1\nGene ID (NCBI): 10140\nRRID: AB_3671523\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P50616\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888670855337,"sku":"83944-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83944-1-rr","provider":"Iright","version":"1.0","type":"link"}