{"product_id":"proteintech-83958-2-rr","title":"Proteintech, 83958-2-RR, PEA15 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PEA15 (83958-2-RR) by Proteintech is a Recombinant antibody targeting PEA15 in WB, ELISA applications with reactivity to human, mouse, rat samples\n83958-2-RR targets PEA15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, COLO 320 cells,  Neuro-2a cells,  SH-SY5Y cells,  U-87 MG cells,  fetal human brain tissue,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphoprotein Enriched in Astrocytes 15 kDa (PEA15), also known as PED-15, is a small, death effector-domain (DED)-containing protein that was recently demonstrated to inhibit tumor necrosis factor-α-induced apoptosis and to reverse the inhibition of integrin activation due to H-Ras. PEA15 is a 15 kDa protein that is highly expressed in the nervous system with particularly high levels in astrocytes and neurons of the hippocampus. PEA15 is a cytoplasmic protein that sits at an important junction in intracellular signalling and can regulate diverse cellular processes, such as proliferation and apoptosis, dependent upon stimulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species\nFull Name: phosphoprotein enriched in astrocytes 15\nCalculated Molecular Weight: 130 aa, 15 kDa\nObserved Molecular Weight: 13-15 kDa\nGenBank Accession Number: BC002426\nGene Symbol: PEA15\nGene ID (NCBI): 8682\nRRID: AB_3671535\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15121\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888655323305,"sku":"83958-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83958-2-rr","provider":"Iright","version":"1.0","type":"link"}