{"product_id":"proteintech-83986-2-rr","title":"Proteintech, 83986-2-RR, NMI Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NMI (83986-2-RR) by Proteintech is a Recombinant antibody targeting NMI in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83986-2-RR targets NMI in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  PC-3 cells,  HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nN-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34759 Product name: Recombinant human NMI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC001268 Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI Predict reactive species\nFull Name: N-myc (and STAT) interactor\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC001268\nGene Symbol: NMI\nGene ID (NCBI): 9111\nRRID: AB_3671560\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13287\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888437547177,"sku":"83986-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83986-2-rr","provider":"Iright","version":"1.0","type":"link"}