{"product_id":"proteintech-83989-4-rr","title":"Proteintech, 83989-4-RR, TPRG1L Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TPRG1L (83989-4-RR) by Proteintech is a Recombinant antibody targeting TPRG1L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n83989-4-RR targets TPRG1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPRG1L (Tumor protein p63-regulated gene 1-like protein) belongs to the presynaptic protein involved in the synaptic transmission tuning. It can regulate synaptic release probability by decreasing the calcium sensitivity of release. TPRG1L has two isoforms with molecular weights of 30kd and 23kd respectively. This antibody can recognize the 30kd isoform and may also recognize the 23kd isoform.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22585 Product name: Recombinant human TPRG1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC019034 Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEREGFGIRIQWDKQSRPSFI Predict reactive species\nFull Name: tumor protein p63 regulated 1-like\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC019034\nGene Symbol: TPRG1L\nGene ID (NCBI): 127262\nRRID: AB_3671565\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q5T0D9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888520810665,"sku":"83989-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83989-4-rr","provider":"Iright","version":"1.0","type":"link"}