{"product_id":"proteintech-83994-3-rr","title":"Proteintech, 83994-3-RR, CDK4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDK4 (83994-3-RR) by Proteintech is a Recombinant antibody targeting CDK4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n83994-3-RR targets CDK4 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  MCF-7 cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human cervical squamous cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1-to S-phase transition during the cell cycle, and its expression is primarily controlled at the transcriptional level(PMID:17253961). The CCND1-CDK4 axis is critical not only in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment, which are vital to sustain tumor outgrowth (PMID:21844184).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag20538 Product name: Recombinant human CDK4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-303 aa of BC010153 Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Predict reactive species\nFull Name: cyclin-dependent kinase 4\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 30-34 kDa\nGenBank Accession Number: BC010153\nGene Symbol: CDK4\nGene ID (NCBI): 1019\nRRID: AB_3671570\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P11802\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888348549289,"sku":"83994-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-83994-3-rr","provider":"Iright","version":"1.0","type":"link"}