{"product_id":"proteintech-84007-5-rr","title":"Proteintech, 84007-5-RR, EXOC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EXOC1 (84007-5-RR) by Proteintech is a Recombinant antibody targeting EXOC1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84007-5-RR targets EXOC1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  C1C12 cells,  rat brain tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEXOC1 (exocyst complex component 1), also known as SEC3, is a component of the exocyst complex which is essential for the targeting of exocytic vesicles to specific docking sites on the plasma membrane. The exocyst complex is an octameric complex that tethers vesicles at the plasma membrane, regulates polarized exocytosis, and recruits membranes and proteins required for nanotube formation.Recently it has been reported that exocyst complex proteins are likely a key effector of Nef-mediated enhancement of nanotube formation, and possibly microvesicle secretion, which suggests a new paradigm of exocyst involvement in polarized targeting for intercellular transfer of viral proteins and viruses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2303 Product name: Recombinant human EXOC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-488 aa of BC020650 Sequence: MPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH Predict reactive species\nFull Name: exocyst complex component 1\nCalculated Molecular Weight: 894 aa, 102 kDa\nObserved Molecular Weight: 102 kDa\nGenBank Accession Number: BC020650\nGene Symbol: EXOC1\nGene ID (NCBI): 55763\nRRID: AB_3671576\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9NV70\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888742879401,"sku":"84007-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84007-5-rr","provider":"Iright","version":"1.0","type":"link"}