{"product_id":"proteintech-84072-5-rr","title":"Proteintech, 84072-5-RR, Leptin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Leptin (84072-5-RR) by Proteintech is a Recombinant antibody targeting Leptin in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84072-5-RR targets Leptin in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: 3T3-L1 cells\nPositive FC (Intra) detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeptin is a product of the obese (ob) gene and, following synthesis and secretion from fat cells in white adipose tissue, binds to and activates its cognate receptor, the leptin receptor (LEP-R) (PMID: 34084149). Still, smaller quantities have been detected in other body tissues, including the brown adipose tissue (BAT), placenta, fetal tissue, stomach, muscles, bone marrow, teeth, and brain (PMID:7568067, PMID: 12086939). Leptin circulates in the blood in both free and protein-bound forms, where the free form of leptin is the biologically active form (PMID: 12086939). Leptin can enter the central nervous system (CNS) (in the area of the choroid plexus) by receptor-mediated transport (PMID: 29254602). Leptin secretion is higher in subcutaneous than in visceral adipose tissue (PMID: 11133069, PMID: 14726444).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0834 Product name: Recombinant Human Leptin protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 22-167 aa of BC060830 Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC Predict reactive species\nFull Name: leptin\nCalculated Molecular Weight: 167 aa, 19 kDa\nGenBank Accession Number: BC060830\nGene Symbol: Leptin\nGene ID (NCBI): 3952\nRRID: AB_3671642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P41159\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888861302953,"sku":"84072-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84072-5-rr","provider":"Iright","version":"1.0","type":"link"}