{"product_id":"proteintech-84085-3-rr","title":"Proteintech, 84085-3-RR, MYO6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MYO6 (84085-3-RR) by Proteintech is a Recombinant antibody targeting MYO6 in WB, ELISA applications with reactivity to human samples\n84085-3-RR targets MYO6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, LNCaP cells,  HEK-293T cells,  DU 145 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYO6, an actin-based motor protein, is the only myosin known to move toward the minus end of actin filaments. MYO6 is highly expressed in the inner and outer hair cells of the ear, retina, and polarized epithelial cells such as kidney proximal tubule cells and intestinal enterocytes. And it participates in a wide range of biological processes within cells, including clathrin-mediated endocytosis, vesicular membrane traffic, polarized secretion, and autophagy (PMID: 23620821; PMID: 28591580). Previous studies showed that MYO6 is upregulated in various types of cancer, and it has been widely reported to contribute to tumor cell migration and metastasis. Some articles indicate that MYO6 is associated with prostate cancer, lung cancer, human colorectal cancer and gastric cancer (PMID: 29022908).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24906 Product name: Recombinant human MYO6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC146764 Sequence: MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQ Predict reactive species\nFull Name: myosin VI\nCalculated Molecular Weight: 1285 aa, 149 kDa\nObserved Molecular Weight: 145-150 kDa\nGenBank Accession Number: BC146764\nGene Symbol: MYO6\nGene ID (NCBI): 4646\nRRID: AB_3671653\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UM54\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888651456681,"sku":"84085-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84085-3-rr","provider":"Iright","version":"1.0","type":"link"}