{"product_id":"proteintech-84089-4-rr","title":"Proteintech, 84089-4-RR, TCF1\/TCF7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TCF1\/TCF7 (84089-4-RR) by Proteintech is a Recombinant antibody targeting TCF1\/TCF7 in WB, ELISA applications with reactivity to human, mouse samples\n84089-4-RR targets TCF1\/TCF7 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, mouse thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCF7, also known as TCF1, belongs to the TCF\/LEF family. TCF7 is part of the Wnt signaling pathway and plays an important role in the differentiation and self-renewal of memory T cells. It has been found that TCF7 is necessary to revive T cells in response to PD-1 blockade against viral infection or cancer. TCF7 is mainly expressed in T-cells and is also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. TCF7 has 16 isoforms with the molecular mass of 28-54 kDa (PMID: 34044317).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5792 Product name: Recombinant human TCF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-384 aa of BC048769 Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL Predict reactive species\nFull Name: transcription factor 7 (T-cell specific, HMG-box)\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC048769\nGene Symbol: TCF1\/TCF7\nGene ID (NCBI): 6932\nENSEMBL Gene ID: ENSG00000081059\nRRID: AB_3671655\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P36402\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888535687337,"sku":"84089-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84089-4-rr","provider":"Iright","version":"1.0","type":"link"}