{"product_id":"proteintech-84150-2-rr","title":"Proteintech, 84150-2-RR, FAM136A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FAM136A (84150-2-RR) by Proteintech is a Recombinant antibody targeting FAM136A in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84150-2-RR targets FAM136A in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cell,  Jurkat cell,  MCF-7 cell,  U2OS cell,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM136A is an evolutively conserved nuclear gene encoding a mitochondrial protein whose specific function is unknown, but which is commonly found in neurosensory epithelial cells, where it plays a role in the electron transport chain of respiration (PMID: 37461313). FAM136A, with a molecular mass of 16-kDa, is normally expressed in the cytoplasm and has been linked to familial Meniere's disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34058 Product name: Recombinant human FAM136A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC014975 Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK Predict reactive species\nFull Name: family with sequence similarity 136, member A\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC014975\nGene Symbol: FAM136A\nGene ID (NCBI): 84908\nRRID: AB_3671715\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96C01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888355004585,"sku":"84150-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84150-2-rr","provider":"Iright","version":"1.0","type":"link"}