{"product_id":"proteintech-84160-3-rr","title":"Proteintech, 84160-3-RR, GPNMB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GPNMB (84160-3-RR) by Proteintech is a Recombinant antibody targeting GPNMB in WB, IF\/ICC, ELISA applications with reactivity to human samples\n84160-3-RR targets GPNMB in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, THP-1 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14124 Product name: Recombinant human GPNMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-181 aa of BC011595 Sequence: AKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLG Predict reactive species\nFull Name: glycoprotein (transmembrane) nmb\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 120 kDa, 95 kDa\nGenBank Accession Number: BC011595\nGene Symbol: GPNMB\nGene ID (NCBI): 10457\nRRID: AB_3671722\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14956\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888640086185,"sku":"84160-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84160-3-rr","provider":"Iright","version":"1.0","type":"link"}