{"product_id":"proteintech-84194-6-rr","title":"Proteintech, 84194-6-RR, ATAD1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ATAD1 (84194-6-RR) by Proteintech is a Recombinant antibody targeting ATAD1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84194-6-RR targets ATAD1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, A549 cells,  Jurkat cells,  HeLa cells,  HepG2 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mitochondrial AAA (ATPase Associated with diverse cellular Activities) protein ATAD1 (in humans; Msp1 in yeast) removes mislocalized membrane proteins, as well as stuck import substrates from the mitochondrial outer membrane, facilitating their re-insertion into their cognate organelles and maintaining mitochondria's protein import capacity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10343 Product name: Recombinant human ATAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-361 aa of BC010868 Sequence: DKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD Predict reactive species\nFull Name: ATPase family, AAA domain containing 1\nCalculated Molecular Weight: 361 aa, 41 kDa\nObserved Molecular Weight: 32-37 kDa\nGenBank Accession Number: BC010868\nGene Symbol: ATAD1\nGene ID (NCBI): 84896\nRRID: AB_3671746\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8NBU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888391409833,"sku":"84194-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84194-6-rr","provider":"Iright","version":"1.0","type":"link"}