{"product_id":"proteintech-84196-3-rr","title":"Proteintech, 84196-3-RR, TMEM106B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMEM106B (84196-3-RR) by Proteintech is a Recombinant antibody targeting TMEM106B in IHC, ELISA applications with reactivity to human, mouse samples\n84196-3-RR targets TMEM106B in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression. TMEM106B can be showed as 31-55 kDa and 70-90 kDa (Glycosylated or Dimer) form in western blot test. (PMID: 27543298, 22895706, PMID: 23136129).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4518 Product name: recombinant human TMEM106B protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 119-274 aa of BC033901 Sequence: RSIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ Predict reactive species\nFull Name: transmembrane protein 106B\nCalculated Molecular Weight: 31 kDa\nGenBank Accession Number: BC033901\nGene Symbol: TMEM106B\nGene ID (NCBI): 54664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NUM4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888833122473,"sku":"84196-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84196-3-rr","provider":"Iright","version":"1.0","type":"link"}