{"product_id":"proteintech-84212-3-rr","title":"Proteintech, 84212-3-RR, CD23 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD23 (84212-3-RR) by Proteintech is a Recombinant antibody targeting CD23 in WB, IHC, IF-P, ELISA applications with reactivity to mouse samples\n84212-3-RR targets CD23 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse thymus tissue, mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD23\/Fc ε RII) is a low-affinity receptor for immunoglobulin E (IgE) and CR2\/CD21, involved in B cell differentiation and IgE regulation. Two forms of Fc ε RII (Fc ε RIIa and Fc ε RIIb) were found to exist, which differ in structure only in the N-terminal cytoplasmic region, and Fc ε RIIa and Fc ε RIIb play roles in effector cells of B-cell and IgE-mediated immunity, respectively. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells. On macrophages, after IgE binding and antigen cross-linking, intracellular killing of parasites is induced by activation of the L-arginine-nitric oxide pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1295 Product name: Recombinant Mouse CD23 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 51-331 aa of EDL21948.1 Sequence: TEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP Predict reactive species\nFull Name: Fc receptor, IgE, low affinity II, alpha polypeptide\nCalculated Molecular Weight: 38kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: EDL21948.1\nGene Symbol: Fcer2a\nGene ID (NCBI): 14128\nRRID: AB_3671769\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P20693-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888719843497,"sku":"84212-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84212-3-rr","provider":"Iright","version":"1.0","type":"link"}