{"product_id":"proteintech-84213-5-rr","title":"Proteintech, 84213-5-RR, ATP2A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ATP2A1 (84213-5-RR) by Proteintech is a Recombinant antibody targeting ATP2A1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84213-5-RR targets ATP2A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:125-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP2A1 also known as SERCA1, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen and is involved in muscular excitation and contraction. Mutations in ATP2A1 cause some autosomal recessive forms of Brody disease(PMID: 23911890, 10914677).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17944 Product name: Recombinant human ATP2A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 561-635 aa of BC037354 Sequence: RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG Predict reactive species\nFull Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1\nCalculated Molecular Weight: 1001 aa, 110 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC037354\nGene Symbol: ATP2A1\nGene ID (NCBI): 487\nRRID: AB_3671770\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O14983\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888351400105,"sku":"84213-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84213-5-rr","provider":"Iright","version":"1.0","type":"link"}