{"product_id":"proteintech-84239-2-rr","title":"Proteintech, 84239-2-RR, APOBEC3A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe APOBEC3A (84239-2-RR) by Proteintech is a Recombinant antibody targeting APOBEC3A in IF\/ICC, ELISA applications with reactivity to human samples\n84239-2-RR targets APOBEC3A in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAPOBEC3A, also known as A3A, belongs to the cytidine and deoxycytidylate deaminase family. APOBEC3A plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. APOBEC3A is expressed in several cell types, including keratinocytes and myeloid cells (PMID: 28825669). APOBEC3A has 2 isoforms with the molecular mass of 22 and 23 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18845 Product name: Recombinant human APOBEC3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC126416 Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN Predict reactive species\nFull Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A\nCalculated Molecular Weight: 199 aa, 23 kDa\nGenBank Accession Number: BC126416\nGene Symbol: APOBEC3A\nGene ID (NCBI): 200315\nRRID: AB_3671791\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P31941\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888852127913,"sku":"84239-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84239-2-rr","provider":"Iright","version":"1.0","type":"link"}