{"product_id":"proteintech-84272-1-rr","title":"Proteintech, 84272-1-RR, METTL1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe METTL1 (84272-1-RR) by Proteintech is a Recombinant antibody targeting METTL1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n84272-1-RR targets METTL1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  Caco-2 cells,  HuH-7 cells,  mouse brain tissue\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMETTL1 methyltransferase mediates m7G methylation within miRNAs and regulates cell migration via its catalytic activity. METTL1 can be inactivated by phosphorylation at Ser27 by protein kinase B (PKBα). Overexpression of METTL1 is widely observed among human cancers. It is also crucial for the regulation of chemoresistance in cancer treatment. In addition, mutations in the human N7-methylguanosine (m7G) methyltransferase complex METTL1\/WDR4 cause primordial dwarfism and brain malformation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7055 Product name: Recombinant human METTL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-276 aa of BC000550 Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH Predict reactive species\nFull Name: methyltransferase like 1\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC000550\nGene Symbol: METTL1\nGene ID (NCBI): 4234\nRRID: AB_3671818\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UBP6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888435056809,"sku":"84272-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84272-1-rr","provider":"Iright","version":"1.0","type":"link"}