{"product_id":"proteintech-84292-4-rr","title":"Proteintech, 84292-4-RR, ADAM17 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ADAM17 (84292-4-RR) by Proteintech is a Recombinant antibody targeting ADAM17 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n84292-4-RR targets ADAM17 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HCT 116 cells,  HUVEC cells,  SW480 cells,  HeLa cells,  RAW 264.7 cells\nPositive IHC detected in: human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HCT 116 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32418 Product name: Recombinant human ADAM17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 693-824 aa of BC136783 Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Predict reactive species\nFull Name: ADAM metallopeptidase domain 17\nCalculated Molecular Weight: 824 aa, 93 kDa\nObserved Molecular Weight: 100-130 kDa\nGenBank Accession Number: BC136783\nGene Symbol: ADAM17\nGene ID (NCBI): 6868\nRRID: AB_3671836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P78536\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888536866985,"sku":"84292-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84292-4-rr","provider":"Iright","version":"1.0","type":"link"}