{"product_id":"proteintech-84296-4-rr","title":"Proteintech, 84296-4-RR, ARFGEF2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ARFGEF2 (84296-4-RR) by Proteintech is a Recombinant antibody targeting ARFGEF2 in WB, IHC, ELISA applications with reactivity to human samples\n84296-4-RR targets ARFGEF2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  HEK-293T cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. ARFGEF2 is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. ARFGEF2 contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35396 Product name: Recombinant human ARFGEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-370 aa of BC050449 Sequence: PIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHVL Predict reactive species\nFull Name: ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)\nObserved Molecular Weight: 202 kDa\nGenBank Accession Number: BC050449\nGene Symbol: ARFGEF2\nGene ID (NCBI): 10564\nRRID: AB_3671837\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y6D5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888589328553,"sku":"84296-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84296-4-rr","provider":"Iright","version":"1.0","type":"link"}